PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q5TGZ0 to PF04418 (DUF543)

SwissProt::Q5TGZ0 has 78 amino acids

Query:       DUF543  [M=74]
Accession:   PF04418.12
Description: Domain of unknown function (DUF543)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    3.5e-28   83.8   0.4    3.8e-28   83.6   0.4    1.0  1  SwissProt::Q5TGZ0  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q5TGZ0  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   83.6   0.4   3.8e-28   3.8e-28      13      73 ..       2      62 ..       1      63 [. 0.96

  Alignments for each domain:
  == domain 1  score: 83.6 bits;  conditional E-value: 3.8e-28
             DUF543 13 sesdldekwDaclsnllvkvglgllvGvvasvllfrrRaapvalGaGvGiGaAYtecsalF 73
                       ses+l +kwD+cl++++vk+g g++ G+v+s+ +f+rR++p a+G G+G+G+AY++c+  F
  SwissProt::Q5TGZ0  2 SESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDF 62
                       56899******************************************************99 PP



Or compare SwissProt::Q5TGZ0 to CDD or PaperBLAST