VIMSS6581170 has 97 amino acids
Query: DUF543 [M=75]
Accession: PF04418.16
Description: Domain of unknown function (DUF543)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.2e-36 109.9 0.2 2.9e-36 109.6 0.2 1.2 1 VIMSS6581170
Domain annotation for each sequence (and alignments):
>> VIMSS6581170
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 109.6 0.2 2.9e-36 2.9e-36 6 75 .] 19 87 .. 4 87 .. 0.86
Alignments for each domain:
== domain 1 score: 109.6 bits; conditional E-value: 2.9e-36
DUF543 6 kkkkskpssesllnekwDvcLsnllvktglGlgvGvvasvllfrrRaapvwlGlGfGlGraYaecdasFr 75
++k+ + + +++l+ kwD +Lsn+lvkt++G+gvGv++svl+f+rRa+pvwlG+GfG+Gr+Yae+da+Fr
VIMSS6581170 19 SNKNGSSV-STILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGDAIFR 87
23333333.69**********************************************************6 PP
Or compare VIMSS6581170 to CDD or PaperBLAST