XP_001481728.1 has 91 amino acids
Query: DUF543 [M=75]
Accession: PF04418.16
Description: Domain of unknown function (DUF543)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.6e-36 110.4 0.1 2e-36 110.1 0.1 1.0 1 XP_001481728.1
Domain annotation for each sequence (and alignments):
>> XP_001481728.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 110.1 0.1 2e-36 2e-36 5 75 .] 9 79 .. 5 79 .. 0.95
Alignments for each domain:
== domain 1 score: 110.1 bits; conditional E-value: 2e-36
DUF543 5 ekkkkskpssesllnekwDvcLsnllvktglGlgvGvvasvllfrrRaapvwlGlGfGlGraYaecdasFr 75
+++kp+se+llnekwD+++s+++++++lGl++Gvv+svllf+rRa+p+w+GlGfG+Gra++e+dasFr
XP_001481728.1 9 PVLRSTKPVSEALLNEKWDRAISSMIIRSSLGLSFGVVFSVLLFKRRAWPAWVGLGFGAGRAWEEADASFR 79
556789****************************************************************6 PP
Or compare XP_001481728.1 to CDD or PaperBLAST