PaperBLAST – Find papers about a protein or its homologs

 

Align NP_414960.2 to PF04461 (DUF520)

NP_414960.2 has 163 amino acids

Query:       DUF520  [M=161]
Accession:   PF04461.13
Description: Protein of unknown function (DUF520)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.4e-69  219.5   3.6    1.5e-69  219.4   3.6    1.0  1  NP_414960.2  


Domain annotation for each sequence (and alignments):
>> NP_414960.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  219.4   3.6   1.5e-69   1.5e-69       1     161 []       2     162 ..       2     162 .. 1.00

  Alignments for each domain:
  == domain 1  score: 219.4 bits;  conditional E-value: 1.5e-69
       DUF520   1 psfDivsevdlqevknAvdqakkeistRfDfkgskaeielkekekeitltaesefklkqvkdilksklvkrgvdlkaldlgkvekasgkkvkqevklk 98 
                  psfDivsevdlqe +nAvd+a++e+++RfDf++++a++el++ +k+i++ +es+f+++q++dil++kl+krg++ ++ld+ ++  +sgk++  e+klk
  NP_414960.2   2 PSFDIVSEVDLQEARNAVDNASREVESRFDFRNVEASFELNDASKTIKVLSESDFQVNQLLDILRAKLLKRGIEGSSLDVPENIVHSGKTWFVEAKLK 99 
                  7************************************************************************************************* PP

       DUF520  99 egidkekakkivklikdsklkvqasiqgdevRvtgkkrDdLQaviallkkedldlplqftNfr 161
                  +gi++ + kkivk+ikdsklkvqa+iqgde+Rvtgk+rDdLQav+a+++  dl++p+qf+Nfr
  NP_414960.2 100 QGIESATQKKIVKMIKDSKLKVQAQIQGDEIRVTGKSRDDLQAVMAMVRGGDLGQPFQFKNFR 162
                  **************************************************************9 PP



Or compare NP_414960.2 to CDD or PaperBLAST