PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1819284 to PF04461 (DUF520)

VIMSS1819284 has 161 amino acids

Query:       DUF520  [M=161]
Accession:   PF04461.13
Description: Protein of unknown function (DUF520)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    4.8e-65  204.7   6.2    5.4e-65  204.6   6.2    1.0  1  VIMSS1819284  


Domain annotation for each sequence (and alignments):
>> VIMSS1819284  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  204.6   6.2   5.4e-65   5.4e-65       1     161 []       2     160 ..       2     160 .. 0.98

  Alignments for each domain:
  == domain 1  score: 204.6 bits;  conditional E-value: 5.4e-65
        DUF520   1 psfDivsevdlqevknAvdqakkeistRfDfkgskaeielkekekeitltaesefklkqvkdilksklvkrgvdlkaldlgkvekasgkkvkqevkl 97 
                   psfD+vsev+++e++nAvdqa++e++tRfDfkg++a++el++  k i+ +a s+f++kq++dil+++l+ rg+d+++l++g+  +++   ++q+v++
  VIMSS1819284   2 PSFDVVSEVNKHELTNAVDQANRELDTRFDFKGVQAKFELED-GKVINQSAPSDFQVKQMTDILRARLLARGIDVRCLEFGD-METNLAGARQKVTV 96 
                   7***************************************77.78************************************9.66778889****** PP

        DUF520  98 kegidkekakkivklikdsklkvqasiqgdevRvtgkkrDdLQaviallkkedldlplqftNfr 161
                   k+gi++++ak++v ++k++klkv+a+i+gd++R+tgkkrDdLQ++iallkk+d++lplqf+Nfr
  VIMSS1819284  97 KQGIEQKQAKQLVAKLKEAKLKVEAQINGDKLRITGKKRDDLQDAIALLKKADFELPLQFDNFR 160
                   ***************************************************************9 PP



Or compare VIMSS1819284 to CDD or PaperBLAST