PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS217047 to PF04461 (DUF520)

VIMSS217047 has 161 amino acids

Query:       DUF520  [M=161]
Accession:   PF04461.13
Description: Protein of unknown function (DUF520)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.6e-67  212.8   7.3    1.8e-67  212.6   7.3    1.0  1  VIMSS217047  


Domain annotation for each sequence (and alignments):
>> VIMSS217047  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  212.6   7.3   1.8e-67   1.8e-67       1     161 []       2     160 ..       2     160 .. 0.98

  Alignments for each domain:
  == domain 1  score: 212.6 bits;  conditional E-value: 1.8e-67
       DUF520   1 psfDivsevdlqevknAvdqakkeistRfDfkgskaeielkekekeitltaesefklkqvkdilksklvkrgvdlkaldlgkvekasgkkvkqevklk 98 
                  psfD+vse+d++ev+nAvd+a ke+++R+D+kg+  ++e+k+ke++++ltae+ef+l+++++il+  lvkr++d+k+l++++ + asgk+ kqe+k++
  VIMSS217047   2 PSFDVVSELDKHEVQNAVDNAIKELDRRYDLKGK-GTFEFKDKEQTVMLTAEEEFQLEAMLEILRLALVKRKIDVKCLETKD-PYASGKEKKQEAKFR 97 
                  7********************************6.5799*****************************************99.9************** PP

       DUF520  99 egidkekakkivklikdsklkvqasiqgdevRvtgkkrDdLQaviallkkedldlplqftNfr 161
                  egidk+ akkiv +ikd klkvqa+iqg++vRvtgkkrDdLQ++iall+++++d+plqf+Nfr
  VIMSS217047  98 EGIDKDLAKKIVATIKDGKLKVQAAIQGEQVRVTGKKRDDLQEAIALLRTKEFDMPLQFNNFR 160
                  **************************************************************9 PP



Or compare VIMSS217047 to CDD or PaperBLAST