PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS32337 to PF04461 (DUF520)

VIMSS32337 has 163 amino acids

Query:       DUF520  [M=161]
Accession:   PF04461.13
Description: Protein of unknown function (DUF520)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    1.5e-66  209.6   6.4    1.7e-66  209.4   6.4    1.0  1  VIMSS32337  


Domain annotation for each sequence (and alignments):
>> VIMSS32337  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  209.4   6.4   1.7e-66   1.7e-66       1     161 []       4     163 .]       4     163 .] 0.98

  Alignments for each domain:
  == domain 1  score: 209.4 bits;  conditional E-value: 1.7e-66
      DUF520   1 psfDivsevdlqevknAvdqakkeistRfDfkgskaeielkekekeitltaesefklkqvkdilksklvkrgvdlkaldlgkvekasgkkvkqevklke 99 
                 +sfDivs+vd+qev+nA++qa+ke++tRfDf+g++++i +k  +++++lt+++e+++k+ +d++k+kl++r+++lka+++g+ ++asgk++k +  lk+
  VIMSS32337   4 SSFDIVSKVDRQEVDNALNQAAKELATRFDFRGTDTKIAWKG-DEAVELTSSTEERVKAAVDVFKEKLIRRDISLKAFEAGE-PQASGKTYKVTGALKQ 100
                 59**************************************88.88************************************9.99************** PP

      DUF520 100 gidkekakkivklikdskl.kvqasiqgdevRvtgkkrDdLQaviallkkedldlplqftNfr 161
                 gi++e+akki+kli+d++   v+++iqgdevRvt+kkrDdLQavia+lkk+dld++lqf+N+r
  VIMSS32337 101 GISSENAKKITKLIRDAGPkNVKTQIQGDEVRVTSKKRDDLQAVIAMLKKADLDVALQFVNYR 163
                 ******************967*****************************************9 PP



Or compare VIMSS32337 to CDD or PaperBLAST