PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS3342410 to PF04461 (DUF520)

VIMSS3342410 has 164 amino acids

Query:       DUF520  [M=161]
Accession:   PF04461.13
Description: Protein of unknown function (DUF520)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    3.6e-62  195.4   8.6    4.1e-62  195.2   8.6    1.0  1  VIMSS3342410  


Domain annotation for each sequence (and alignments):
>> VIMSS3342410  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  195.2   8.6   4.1e-62   4.1e-62       2     161 .]       5     164 .]       4     164 .] 0.98

  Alignments for each domain:
  == domain 1  score: 195.2 bits;  conditional E-value: 4.1e-62
        DUF520   2 sfDivsevdlqevknAvdqakkeistRfDfkgskaeielkekekeitltaesefklkqvkdilksklvkrgvdlkaldlgkvekasgkkvkqevklk 98 
                   sfD+vs++d+qe+ n++dq+++++ +R+D+k+s++eiel+e   ++++t+ s+++l++v+d+l++k++kr+++lk++d+++ e + g++vkq+v+lk
  VIMSS3342410   5 SFDVVSDFDRQELVNTLDQVRRDVGQRYDLKDSNTEIELEE--AAVVITTASDMTLQAVEDVLRAKATKRNLSLKIFDFQTPEAVGGNRVKQVVQLK 99 
                   9**************************************66..89**************************************************** PP

        DUF520  99 egidkekakkivklikdsklkvqasiqgdevRvtgkkrDdLQaviallkke..dldlplqftNfr 161
                   +g+++e akk++k+++d+  kv+++iqg+++Rvtgk++DdLQ+vi+ll+++  +ld+plqf+N+r
  VIMSS3342410 100 KGLSQELAKKMSKIVRDELKKVTVAIQGESLRVTGKSKDDLQQVIQLLRSKedELDVPLQFENYR 164
                   ************************************************986569**********9 PP



Or compare VIMSS3342410 to CDD or PaperBLAST