PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS537999 to PF04461 (DUF520)

VIMSS537999 has 163 amino acids

Query:       DUF520  [M=161]
Accession:   PF04461.13
Description: Protein of unknown function (DUF520)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.2e-66  209.1   4.3    2.5e-66  208.9   4.3    1.0  1  VIMSS537999  


Domain annotation for each sequence (and alignments):
>> VIMSS537999  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  208.9   4.3   2.5e-66   2.5e-66       1     161 []       4     163 .]       4     163 .] 0.98

  Alignments for each domain:
  == domain 1  score: 208.9 bits;  conditional E-value: 2.5e-66
       DUF520   1 psfDivsevdlqevknAvdqakkeistRfDfkgskaeielkekekeitltaesefklkqvkdilksklvkrgvdlkaldlgkvekasgkkvkqevklk 98 
                  +sfDivs+vd+qev+nA++qa+ke++tRfDf+g++++i +k  +++i+lt+++ +++k+ +d++k+kl++r++++ka+d+g+ ++asgk++k + +lk
  VIMSS537999   4 SSFDIVSKVDRQEVDNALNQAAKELATRFDFRGTDTTIAWKG-DEAIELTSSTGERVKAAVDVFKEKLIRRDISMKAFDAGE-PQASGKTYKVNGTLK 99 
                  59**************************************88.88************************************9.99************* PP

       DUF520  99 egidkekakkivklikdskl.kvqasiqgdevRvtgkkrDdLQaviallkkedldlplqftNfr 161
                  +gi++e+akki+kli+d++   v+++iqgde+Rv++kkrDdLQavia+lk++dld++lqf+N+r
  VIMSS537999 100 QGISSESAKKITKLIRDEGPkGVKTQIQGDEIRVSSKKRDDLQAVIAMLKQADLDVALQFVNYR 163
                  *******************967*****************************************9 PP



Or compare VIMSS537999 to CDD or PaperBLAST