PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5779224 to PF04461 (DUF520)

VIMSS5779224 has 160 amino acids

Query:       DUF520  [M=161]
Accession:   PF04461.13
Description: Protein of unknown function (DUF520)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    3.4e-63  198.7   5.6    3.8e-63  198.6   5.6    1.0  1  VIMSS5779224  


Domain annotation for each sequence (and alignments):
>> VIMSS5779224  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  198.6   5.6   3.8e-63   3.8e-63       1     161 []       2     159 ..       2     159 .. 0.97

  Alignments for each domain:
  == domain 1  score: 198.6 bits;  conditional E-value: 3.8e-63
        DUF520   1 psfDivsevdlqevknAvdqakkeistRfDfkgskaeielkekekeitltaesefklkqvkdilksklvkrgvdlkaldlgkvekasgkkvkqevkl 97 
                   psfD+vsevd++e++nA+dqa++e++tRfDfkg++a++e +   + i+ +a +ef+lkq++dil+++l+ rg+d+ +l++g+  +++  +++q++++
  VIMSS5779224   2 PSFDVVSEVDTHELTNAIDQANRELATRFDFKGVDAKFERDG--DVINQFAPTEFQLKQMNDILRARLAARGIDVLSLEFGD-IETNLAQARQKITV 95 
                   7**************************************966..79************************************.56778899****** PP

        DUF520  98 kegidkekakkivklikdsklkvqasiqgdevRvtgkkrDdLQaviallkkedldlplqftNfr 161
                   k+gi+++ akki+ ++kd+klkv+++i+gd++Rv+gkkrDdLQ++ia+lk+ +++lplqf+Nfr
  VIMSS5779224  96 KQGIEQKIAKKIAAALKDAKLKVESQINGDKLRVQGKKRDDLQDAIAVLKAGKFELPLQFNNFR 159
                   ***************************************************************9 PP



Or compare VIMSS5779224 to CDD or PaperBLAST