PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS590441 to PF04461 (DUF520)

VIMSS590441 has 162 amino acids

Query:       DUF520  [M=161]
Accession:   PF04461.13
Description: Protein of unknown function (DUF520)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    4.1e-66  208.2   9.6    4.5e-66  208.1   9.6    1.0  1  VIMSS590441  


Domain annotation for each sequence (and alignments):
>> VIMSS590441  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  208.1   9.6   4.5e-66   4.5e-66       1     161 []       2     161 ..       2     161 .. 0.99

  Alignments for each domain:
  == domain 1  score: 208.1 bits;  conditional E-value: 4.5e-66
       DUF520   1 psfDivsevdlqevknAvdqakkeistRfDfkgskaeielkekekeitltaesefklkqvkdilksklvkrgvdlkaldlgkvekasgkkvkqevklk 98 
                  psfDivse++l ev++Av++++kei+tRfDf+g++++iel+ek+kei++++es+f+++qv  +l++++ kr++d++ald +k  +asgk+v q++klk
  VIMSS590441   2 PSFDIVSELELFEVNHAVQNTQKEIQTRFDFRGQDVSIELNEKSKEIKISTESDFQCEQVYSMLENHFYKRKIDVQALDPQK-ATASGKNVVQVIKLK 98 
                  7********************************************************************************9.99************* PP

       DUF520  99 egidkekakkivklikdsklkvqasiqgdevRvtgkkrDdLQaviallkkedldlplqftNfr 161
                  +g+d+++akki+k+ik+s++kvq+siqgd++Rvt kkrD+LQ+v+++l++++++lplqf+Nf+
  VIMSS590441  99 DGLDSDTAKKINKAIKESGIKVQSSIQGDKIRVTDKKRDTLQQVMTFLREQQFGLPLQFNNFK 161
                  **************************************************************7 PP



Or compare VIMSS590441 to CDD or PaperBLAST