PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5925102 to PF04461 (DUF520)

VIMSS5925102 has 161 amino acids

Query:       DUF520  [M=161]
Accession:   PF04461.13
Description: Protein of unknown function (DUF520)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    3.8e-69  218.1   8.4    4.2e-69  217.9   8.4    1.0  1  VIMSS5925102  


Domain annotation for each sequence (and alignments):
>> VIMSS5925102  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  217.9   8.4   4.2e-69   4.2e-69       1     161 []       2     160 ..       2     160 .. 0.99

  Alignments for each domain:
  == domain 1  score: 217.9 bits;  conditional E-value: 4.2e-69
        DUF520   1 psfDivsevdlqevknAvdqakkeistRfDfkgskaeielkekekeitltaesefklkqvkdilksklvkrgvdlkaldlgkvekasgkkvkqevkl 97 
                   psfD+vse ++ evknA++q++keistRfDfkgs+a++e ke  +e+tl+a+++fkl qvkd+l  kl+kr+vd+++ld+gkvek+ g+kvkq v++
  VIMSS5925102   2 PSFDVVSEANMIEVKNAIEQSNKEISTRFDFKGSDARVEQKE--RELTLFADDDFKLGQVKDVLIGKLAKRNVDVRFLDYGKVEKIGGDKVKQIVTV 96 
                   7**************************************855..89*************************************************** PP

        DUF520  98 kegidkekakkivklikdsklkvqasiqgdevRvtgkkrDdLQaviallkkedldlplqftNfr 161
                   k+g++ + akkiv+l+kdsk+kvqasiqgd+vR++g krDdLQ++ia+l+k+ +d+pl+f+Nfr
  VIMSS5925102  97 KKGVTGDLAKKIVRLVKDSKIKVQASIQGDAVRISGTKRDDLQSTIAMLRKDVTDTPLDFNNFR 160
                   ***************************************************************9 PP



Or compare VIMSS5925102 to CDD or PaperBLAST