PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS60845 to PF04461 (DUF520)

VIMSS60845 has 159 amino acids

Query:       DUF520  [M=161]
Accession:   PF04461.13
Description: Protein of unknown function (DUF520)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    4.7e-66  208.0   3.7    5.2e-66  207.9   3.7    1.0  1  VIMSS60845  


Domain annotation for each sequence (and alignments):
>> VIMSS60845  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  207.9   3.7   5.2e-66   5.2e-66       1     161 []       2     158 ..       2     158 .. 0.98

  Alignments for each domain:
  == domain 1  score: 207.9 bits;  conditional E-value: 5.2e-66
      DUF520   1 psfDivsevdlqevknAvdqakkeistRfDfkgskaeielkekekeitltaesefklkqvkdilksklvkrgvdlkaldlgkvekasgkkvkqevklke 99 
                 psfD+vse+d++e++nAvd+a ke+++RfD+kg k+++e k  +k++tltae++f l+q++dil+s+lvkr+vd +++++++    sgk vkq+v+++e
  VIMSS60845   2 PSFDVVSELDKHELTNAVDNAIKELDRRFDLKG-KCSFEAK--DKSVTLTAEADFMLEQMLDILRSNLVKRKVDSQCMEIKD-AYPSGKVVKQDVNFRE 96 
                 7********************************.6889984..599**********************************99.999************* PP

      DUF520 100 gidkekakkivklikdsklkvqasiqgdevRvtgkkrDdLQaviallkkedldlplqftNfr 161
                 gidk+ akkiv lik++klkvqa+iqg++vRvtgkkrDdLQ++iall+ e+l++plqftNfr
  VIMSS60845  97 GIDKDLAKKIVGLIKERKLKVQAAIQGEQVRVTGKKRDDLQEAIALLRGESLGMPLQFTNFR 158
                 *************************************************************9 PP



Or compare VIMSS60845 to CDD or PaperBLAST