PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS7383 to PF04461 (DUF520)

VIMSS7383 has 163 amino acids

Query:       DUF520  [M=161]
Accession:   PF04461.13
Description: Protein of unknown function (DUF520)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence  Description
    ------- ------ -----    ------- ------ -----   ---- --  --------  -----------
    1.3e-69  219.6   3.3    1.4e-69  219.5   3.3    1.0  1  VIMSS7383  


Domain annotation for each sequence (and alignments):
>> VIMSS7383  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  219.5   3.3   1.4e-69   1.4e-69       1     161 []       2     162 ..       2     162 .. 1.00

  Alignments for each domain:
  == domain 1  score: 219.5 bits;  conditional E-value: 1.4e-69
     DUF520   1 psfDivsevdlqevknAvdqakkeistRfDfkgskaeielkekekeitltaesefklkqvkdilksklvkrgvdlkaldlgkvekasgkkvkqevklkeg 100
                psfDivse+ l+ev+nAv++a++ +stR+Df+g++a iel+ek+++i++t+es+f+l+q+++il   ++krg++ ++ld+  +++++gk +++e+klk+g
  VIMSS7383   2 PSFDIVSEITLHEVRNAVENANRVLSTRYDFRGVEAVIELNEKNETIKITTESDFQLEQLIEILIGSCIKRGIEHSSLDIPAESEHHGKLYSKEIKLKQG 101
                7*************************************************************************************************** PP

     DUF520 101 idkekakkivklikdsklkvqasiqgdevRvtgkkrDdLQaviallkkedldlplqftNfr 161
                i++e+akki+kl+kdsk+kvq++iqg++vRvtgk+rDdLQavi+l+k+++l++p+qf+Nfr
  VIMSS7383 102 IETEMAKKITKLVKDSKIKVQTQIQGEQVRVTGKSRDDLQAVIQLVKSAELGQPFQFNNFR 162
                ************************************************************9 PP



Or compare VIMSS7383 to CDD or PaperBLAST