PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS880960 to PF04461 (DUF520)

VIMSS880960 has 159 amino acids

Query:       DUF520  [M=161]
Accession:   PF04461.13
Description: Protein of unknown function (DUF520)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.9e-65  206.1   4.3    2.1e-65  205.9   4.3    1.0  1  VIMSS880960  


Domain annotation for each sequence (and alignments):
>> VIMSS880960  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  205.9   4.3   2.1e-65   2.1e-65       1     161 []       2     158 ..       2     158 .. 0.98

  Alignments for each domain:
  == domain 1  score: 205.9 bits;  conditional E-value: 2.1e-65
       DUF520   1 psfDivsevdlqevknAvdqakkeistRfDfkgskaeielkekekeitltaesefklkqvkdilksklvkrgvdlkaldlgkvekasgkkvkqevklk 98 
                  psfD+vse+d++ev+nAvd+a ke+++R+D+kg+  ++e+ke   ++tltae++f+l+++++ilk  lvkr++d+k+l++++   asgk +kqev+l+
  VIMSS880960   2 PSFDVVSELDKHEVTNAVDNAIKELDRRYDLKGK-GTFEFKE--LTVTLTAEADFQLEAMIEILKLALVKRKIDAKCLEIKD-AYASGKLMKQEVTLR 95 
                  7********************************6.5799966..99**********************************99.99************* PP

       DUF520  99 egidkekakkivklikdsklkvqasiqgdevRvtgkkrDdLQaviallkkedldlplqftNfr 161
                  egidke akkiv  ik++klkvqa+iqg++vRvtgkkrDdLQ++ia+l++ d ++plqf+Nfr
  VIMSS880960  96 EGIDKELAKKIVAHIKEAKLKVQAAIQGEQVRVTGKKRDDLQEAIAALRAYDSGMPLQFNNFR 158
                  **************************************************************9 PP



Or compare VIMSS880960 to CDD or PaperBLAST