PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS951438 to PF04461 (DUF520)

VIMSS951438 has 161 amino acids

Query:       DUF520  [M=161]
Accession:   PF04461.13
Description: Protein of unknown function (DUF520)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.8e-65  204.3   6.5    7.6e-65  204.1   6.5    1.0  1  VIMSS951438  


Domain annotation for each sequence (and alignments):
>> VIMSS951438  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  204.1   6.5   7.6e-65   7.6e-65       1     161 []       2     160 ..       2     160 .. 0.97

  Alignments for each domain:
  == domain 1  score: 204.1 bits;  conditional E-value: 7.6e-65
       DUF520   1 psfDivsevdlqevknAvdqakkeistRfDfkgskaeielkekekeitltaesefklkqvkdilksklvkrgvdlkaldlgkvekasgkkvkqevklk 98 
                  psfD++sevd++e++nAvdqa++e++tRfDfkg++a++el++  k i+ +a s+f++kq++dil+++l+ rg+d+++l++g+v +++   ++q+v++k
  VIMSS951438   2 PSFDVISEVDKHELTNAVDQANRELDTRFDFKGVEAKFELED-GKVINQSAPSDFQVKQMTDILRARLLARGIDVRCLEFGDV-ETNLAGARQKVTVK 97 
                  7***************************************77.78*************************************5.5677889******* PP

       DUF520  99 egidkekakkivklikdsklkvqasiqgdevRvtgkkrDdLQaviallkkedldlplqftNfr 161
                  +gi++++ak++v ++k++klkv+a+i+gd++RvtgkkrDdLQ++ia+lkk+d++lplqf+Nfr
  VIMSS951438  98 QGIEQKQAKQLVAKLKEAKLKVEAQINGDKLRVTGKKRDDLQDAIAVLKKADFELPLQFDNFR 160
                  **************************************************************9 PP



Or compare VIMSS951438 to CDD or PaperBLAST