PaperBLAST – Find papers about a protein or its homologs

 

Align WP_001040153.1 to PF04461 (DUF520)

WP_001040153.1 has 163 amino acids

Query:       DUF520  [M=161]
Accession:   PF04461.13
Description: Protein of unknown function (DUF520)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.6e-67  212.1  12.4    2.9e-67  212.0  12.4    1.0  1  WP_001040153.1  


Domain annotation for each sequence (and alignments):
>> WP_001040153.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  212.0  12.4   2.9e-67   2.9e-67       1     161 []       5     163 .]       5     163 .] 0.99

  Alignments for each domain:
  == domain 1  score: 212.0 bits;  conditional E-value: 2.9e-67
          DUF520   1 psfDivsevdlqevknAvdqakkeistRfDfkgskaeielkekekeitltaesefklkqvkdilksklvkrgvdlkaldlgkvekasgkkvkqev 95 
                     +sfDivs+v+l ev+nA+++a kei++R+Dfkgsk++i+l++  + ++lt+++efkl+qvkd+l sklvkr+v +k+ld+gkve a+g++v+q++
  WP_001040153.1   5 SSFDIVSKVELPEVTNAINTALKEIQNRYDFKGSKSDIKLEK--EVLVLTSDDEFKLEQVKDVLISKLVKRNVPIKNLDYGKVEAAAGNTVRQRA 97 
                     59**************************************66..79************************************************* PP

          DUF520  96 klkegidkekakkivklikdsklkvqasiqgdevRvtgkkrDdLQaviallkkedldlplqftNfr 161
                     +l++gidk++akki+++ik+ klkv++++q+d+vRvt+k+rDdLQavia+++++dl++++qf N+r
  WP_001040153.1  98 TLQQGIDKDNAKKINNIIKEMKLKVKTQVQDDQVRVTAKSRDDLQAVIAAVRSADLPIDVQFINYR 163
                     *****************************************************************9 PP



Or compare WP_001040153.1 to CDD or PaperBLAST