PaperBLAST – Find papers about a protein or its homologs

 

Align WP_002208655.1 to PF04461 (DUF520)

WP_002208655.1 has 163 amino acids

Query:       DUF520  [M=161]
Accession:   PF04461.13
Description: Protein of unknown function (DUF520)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.1e-69  219.9   3.7    1.2e-69  219.7   3.7    1.0  1  WP_002208655.1  


Domain annotation for each sequence (and alignments):
>> WP_002208655.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  219.7   3.7   1.2e-69   1.2e-69       1     161 []       2     162 ..       2     162 .. 1.00

  Alignments for each domain:
  == domain 1  score: 219.7 bits;  conditional E-value: 1.2e-69
          DUF520   1 psfDivsevdlqevknAvdqakkeistRfDfkgskaeielkekekeitltaesefklkqvkdilksklvkrgvdlkaldlgkvekasgkkvkqev 95 
                     psfDivse+d+qev+nAv++a++++++R+Df+++ a++el+ek+++i++++es+f+++q++dil+++l krg++  al++ ++   sgk+++ ++
  WP_002208655.1   2 PSFDIVSEIDMQEVRNAVENATRDLANRWDFRNVPASFELNEKNESIKVVSESDFQVEQLLDILRAQLSKRGIEGAALEIPEEMARSGKTYSVDA 96 
                     7********************************************************************************************** PP

          DUF520  96 klkegidkekakkivklikdsklkvqasiqgdevRvtgkkrDdLQaviallkkedldlplqftNfr 161
                     klk+gi++ +akk+vklikdsklkvqa+iqg++vRvtgk rDdLQav+al++++dl++p+qf+Nfr
  WP_002208655.1  97 KLKQGIESVQAKKLVKLIKDSKLKVQAQIQGEQVRVTGKARDDLQAVMALVRAADLGQPFQFNNFR 162
                     *****************************************************************9 PP



Or compare WP_002208655.1 to CDD or PaperBLAST