PaperBLAST – Find papers about a protein or its homologs

 

Align WP_002357974.1 to PF04461 (DUF520)

WP_002357974.1 has 164 amino acids

Query:       DUF520  [M=161]
Accession:   PF04461.13
Description: Protein of unknown function (DUF520)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.8e-63  199.6   7.7      2e-63  199.5   7.7    1.0  1  WP_002357974.1  


Domain annotation for each sequence (and alignments):
>> WP_002357974.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  199.5   7.7     2e-63     2e-63       2     161 .]       7     164 .]       6     164 .] 0.99

  Alignments for each domain:
  == domain 1  score: 199.5 bits;  conditional E-value: 2e-63
          DUF520   2 sfDivsevdlqevknAvdqakkeistRfDfkgskaeielkekekeitltaesefklkqvkdilksklvkrgvdlkaldlgkvekasgkkvkqevk 96 
                     sfD+vsev+++evknA++ a ke+++RfDfkgs a+i+l++  ++++++ae+++k++qvkdil  klvkr+v +k+++++++eka g++++q  +
  WP_002357974.1   7 SFDVVSEVNMEEVKNAIQIALKELKNRFDFKGSIADIKLEN--DKLVVVAEDDYKVEQVKDILFGKLVKRNVPIKNIHFSESEKALGGTARQYGD 99 
                     9**************************************66..79************************************************** PP

          DUF520  97 lkegidkekakkivklikdsklkvqasiqgdevRvtgkkrDdLQaviallkkedldlplqftNfr 161
                     l +gidke+akki+++ik+s++kv+++iq+d++Rvtgk+rDdLQ+v+all++ dl+++l+f+N+r
  WP_002357974.1 100 LISGIDKENAKKINTAIKNSGIKVKSQIQEDKIRVTGKSRDDLQKVMALLRELDLPMALEFNNYR 164
                     ****************************************************************9 PP



Or compare WP_002357974.1 to CDD or PaperBLAST