PaperBLAST – Find papers about a protein or its homologs

 

Align WP_005881988.1 to PF04461 (DUF520)

WP_005881988.1 has 161 amino acids

Query:       DUF520  [M=161]
Accession:   PF04461.13
Description: Protein of unknown function (DUF520)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    6.1e-71  223.9   9.7    6.7e-71  223.8   9.7    1.0  1  WP_005881988.1  


Domain annotation for each sequence (and alignments):
>> WP_005881988.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  223.8   9.7   6.7e-71   6.7e-71       1     161 []       2     160 ..       2     160 .. 0.99

  Alignments for each domain:
  == domain 1  score: 223.8 bits;  conditional E-value: 6.7e-71
          DUF520   1 psfDivsevdlqevknAvdqakkeistRfDfkgskaeielkekekeitltaesefklkqvkdilksklvkrgvdlkaldlgkvekasgkkvkqev 95 
                     psfD+vse +++ev+nAvdqa+kei tRfDf+gs+a+++ ke  +e+t++a+sef+l qvkd+l++k++kr+vd++++d gk+ek+sg+kvkq+v
  WP_005881988.1   2 PSFDVVSEANMVEVHNAVDQANKEIGTRFDFRGSDARVDQKE--HELTVFADSEFQLGQVKDVLNNKMTKRKVDIRFMDEGKIEKISGDKVKQVV 94 
                     7**************************************855..89************************************************* PP

          DUF520  96 klkegidkekakkivklikdsklkvqasiqgdevRvtgkkrDdLQaviallkkedldlplqftNfr 161
                     ++k+gi+ ++akkivkl+kdsklkvqasiqgd+vRv g+krDdLQ+++a+l+ke +dlpl+f+Nfr
  WP_005881988.1  95 TIKNGIQGDSAKKIVKLVKDSKLKVQASIQGDAVRVAGAKRDDLQSTMAMLRKEVADLPLDFNNFR 160
                     *****************************************************************9 PP



Or compare WP_005881988.1 to CDD or PaperBLAST