PaperBLAST – Find papers about a protein or its homologs

 

Align WP_010073882.1 to PF04461 (DUF520)

WP_010073882.1 has 163 amino acids

Query:       DUF520  [M=161]
Accession:   PF04461.13
Description: Protein of unknown function (DUF520)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    7.5e-69  217.1  10.5    8.5e-69  217.0  10.5    1.0  1  WP_010073882.1  


Domain annotation for each sequence (and alignments):
>> WP_010073882.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  217.0  10.5   8.5e-69   8.5e-69       2     161 .]       6     163 .]       5     163 .] 0.99

  Alignments for each domain:
  == domain 1  score: 217.0 bits;  conditional E-value: 8.5e-69
          DUF520   2 sfDivsevdlqevknAvdqakkeistRfDfkgskaeielkekekeitltaesefklkqvkdilksklvkrgvdlkaldlgkvekasgkkvkqevk 96 
                     sfD+vs+vd+qev+nAv+qakkeis+R+Dfkgs +ei l++  ++i+ltae+efkl++v+d+l+ k++krg++++ald+gkve+as ++++q++k
  WP_010073882.1   6 SFDVVSDVDMQEVDNAVNQAKKEISQRYDFKGSPVEIILND--EDIKLTAENEFKLDAVRDVLRGKFAKRGLSVRALDFGKVENASLGSARQVAK 98 
                     9**************************************77..78************************************************** PP

          DUF520  97 lkegidkekakkivklikdsklkvqasiqgdevRvtgkkrDdLQaviallkkedldlplqftNfr 161
                     + +g++kekak+ivk ikdsk+kvq++i+++++Rvtgk++DdLQavi+llk +d++++lqftN+r
  WP_010073882.1  99 IVKGLSKEKAKDIVKEIKDSKIKVQTQIMDNQLRVTGKDKDDLQAVIQLLKGKDFGIDLQFTNYR 163
                     ****************************************************************9 PP



Or compare WP_010073882.1 to CDD or PaperBLAST