PaperBLAST – Find papers about a protein or its homologs

 

Align WP_010946901.1 to PF04461 (DUF520)

WP_010946901.1 has 161 amino acids

Query:       DUF520  [M=161]
Accession:   PF04461.13
Description: Protein of unknown function (DUF520)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    6.9e-66  207.5   2.5    7.7e-66  207.3   2.5    1.0  1  WP_010946901.1  


Domain annotation for each sequence (and alignments):
>> WP_010946901.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  207.3   2.5   7.7e-66   7.7e-66       1     161 []       2     160 ..       2     160 .. 0.99

  Alignments for each domain:
  == domain 1  score: 207.3 bits;  conditional E-value: 7.7e-66
          DUF520   1 psfDivsevdlqevknAvdqakkeistRfDfkgskaeielkekekeitltaesefklkqvkdilksklvkrgvdlkaldlgkvekasgkkvkqev 95 
                     psfDivs+++ ++++nAvd+a +e+stRfDf+g++a+ielk+   ++tl +es+f+++q++d++++++ kr+++++ +++++++ +sgk +  ++
  WP_010946901.1   2 PSFDIVSKMNEVDLRNAVDNAVREVSTRFDFRGVEATIELKD--LTVTLRSESDFQVRQLEDLFRNHCSKRNLSTSGVEIEDEPVHSGKFYTLTM 94 
                     7***************************************55..99************************************************* PP

          DUF520  96 klkegidkekakkivklikdsklkvqasiqgdevRvtgkkrDdLQaviallkkedldlplqftNfr 161
                     ++k+gid+ +ak+ivk ikd+k kvq+siqgd+vRvtgkkrDdLQ++iallkk++++lplq++Nfr
  WP_010946901.1  95 TFKQGIDQPTAKEIVKYIKDTKAKVQTSIQGDKVRVTGKKRDDLQETIALLKKSNIELPLQYENFR 160
                     *****************************************************************9 PP



Or compare WP_010946901.1 to CDD or PaperBLAST