PaperBLAST – Find papers about a protein or its homologs

 

Align WP_014550960.1 to PF04461 (DUF520)

WP_014550960.1 has 163 amino acids

Query:       DUF520  [M=161]
Accession:   PF04461.13
Description: Protein of unknown function (DUF520)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    9.9e-69  216.7   3.2    1.1e-68  216.6   3.2    1.0  1  WP_014550960.1  


Domain annotation for each sequence (and alignments):
>> WP_014550960.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  216.6   3.2   1.1e-68   1.1e-68       1     161 []       2     162 ..       2     162 .. 1.00

  Alignments for each domain:
  == domain 1  score: 216.6 bits;  conditional E-value: 1.1e-68
          DUF520   1 psfDivsevdlqevknAvdqakkeistRfDfkgskaeielkekekeitltaesefklkqvkdilksklvkrgvdlkaldlgkvekasgkkvkqev 95 
                     psfDivse+ l+ev+nAv++a++ +stR+Df+g++a iel+ek+++i++t+es+f+l+q+++il   ++krg++ ++ld+  +++++gk +++e+
  WP_014550960.1   2 PSFDIVSEITLHEVRNAVENANRVLSTRYDFRGVEAVIELNEKNETIKITTESDFQLEQLIEILIGSCIKRGIEHSSLDIPAESEHHGKLYSKEI 96 
                     7********************************************************************************************** PP

          DUF520  96 klkegidkekakkivklikdsklkvqasiqgdevRvtgkkrDdLQaviallkkedldlplqftNfr 161
                     klk+gi++e+akki+kl+kdsk+kvq++iqg++vRvtgk+r+dLQavi+l+k+++l++p+qf+Nfr
  WP_014550960.1  97 KLKQGIETEMAKKITKLVKDSKIKVQTQIQGEQVRVTGKSRNDLQAVIQLVKSAELGQPFQFNNFR 162
                     *****************************************************************9 PP



Or compare WP_014550960.1 to CDD or PaperBLAST