PaperBLAST – Find papers about a protein or its homologs

 

Align WP_035679074.1 to PF04461 (DUF520)

WP_035679074.1 has 162 amino acids

Query:       DUF520  [M=161]
Accession:   PF04461.13
Description: Protein of unknown function (DUF520)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.4e-63  199.2   0.8    2.7e-63  199.1   0.8    1.0  1  WP_035679074.1  


Domain annotation for each sequence (and alignments):
>> WP_035679074.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  199.1   0.8   2.7e-63   2.7e-63       1     161 []       2     161 ..       2     161 .. 0.97

  Alignments for each domain:
  == domain 1  score: 199.1 bits;  conditional E-value: 2.7e-63
          DUF520   1 psfDivsevdlqevknAvdqakkeistRfDfkgskaeielkekekeitltaesefklkqvkdilksklvkrgvdlkaldlgk.vekasgkkvkqe 94 
                     psfDivs++d++e++nA++ +++ei+tRfDfkgs++++e +e  ++itl a++  kl+q++++l+  +++r++d+ ald++k  e+a+g++++q+
  WP_035679074.1   2 PSFDIVSKTDIHEIDNALNGMRREIETRFDFKGSRCTVERTE--NDITLLADDAPKLEQMQELLRVYVTRRKLDAGALDYSKpPERAAGDALRQV 94 
                     7**************************************866..89**********************************96257899******* PP

          DUF520  95 vklkegidkekakkivklikdsklkvqasiqgdevRvtgkkrDdLQaviallkkedldlplqftNfr 161
                     v++k+gi ++  k ivk+ikd+k+kvq+siqgde+RvtgkkrDdLQ++ial++  ++++plq+ Nfr
  WP_035679074.1  95 VTVKQGIAQDLGKTIVKAIKDAKMKVQVSIQGDELRVTGKKRDDLQDAIALVRGLKIEQPLQYLNFR 161
                     ******************************************************************9 PP



Or compare WP_035679074.1 to CDD or PaperBLAST