VIMSS5850217 has 177 amino acids
Query: DUF559 [M=109]
Accession: PF04480.16
Description: Protein of unknown function (DUF559)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.7e-46 142.9 0.2 2.1e-46 142.6 0.2 1.1 1 VIMSS5850217
Domain annotation for each sequence (and alignments):
>> VIMSS5850217
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 142.6 0.2 2.1e-46 2.1e-46 2 108 .. 57 160 .. 56 161 .. 0.97
Alignments for each domain:
== domain 1 score: 142.6 bits; conditional E-value: 2.1e-46
DUF559 2 klkanarklRreqteaekkLWrllrnrrlsglkfrRqkpigsYivDfvclkaklivelDGaqhdeeeeyDaeRtelLeslGftvlRfkndevlknie 98
++ ++ar+lRr+++++e++LWrllr+rrl+glkfrRq pig+Y+vDf+cl+++live+DG +hd e++Da+R+++L+ +Gf+vlRfknde+ +n++
VIMSS5850217 57 RQLDFARRLRRDAPAMERVLWRLLRDRRLDGLKFRRQLPIGRYVVDFACLRHRLIVEADGPYHD--EARDAQRDAWLAGQGFRVLRFKNDEL-NNPD 150
56789***********************************************************..899**********************9.9*** PP
DUF559 99 evleeilkal 108
+vl il+a+
VIMSS5850217 151 RVLGLILEAC 160
******9987 PP
Or compare VIMSS5850217 to CDD or PaperBLAST