WP_285891545.1 has 78 amino acids
Query: DUF559 [M=109]
Accession: PF04480.16
Description: Protein of unknown function (DUF559)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.2e-25 73.5 0.2 6.9e-25 73.3 0.2 1.0 1 WP_285891545.1
Domain annotation for each sequence (and alignments):
>> WP_285891545.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 73.3 0.2 6.9e-25 6.9e-25 41 107 .. 1 67 [. 1 69 [. 0.97
Alignments for each domain:
== domain 1 score: 73.3 bits; conditional E-value: 6.9e-25
DUF559 41 igsYivDfvclkaklivelDGaqhdeeeeyDaeRtelLeslGftvlRfkndevlknieevleeilka 107
+g++ivDf+c + kli+e+DG+ hd+++eyD+ R+e L+++ + vlRf nd+v n +vle+i ++
WP_285891545.1 1 MGNFIVDFYCPQLKLIIEVDGSIHDNQREYDQCRSEKLKEFVHYVLRFTNDQVIDNLPKVLEKITQT 67
799*************************************************************986 PP
Or compare WP_285891545.1 to CDD or PaperBLAST