PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001104303.1 to PF04502 (DUF572)

NP_001104303.1 has 345 amino acids

Query:       DUF572  [M=332]
Accession:   PF04502.13
Description: Family of unknown function (DUF572)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
   5.6e-117  377.1  10.9   6.4e-117  376.9  10.9    1.0  1  NP_001104303.1  


Domain annotation for each sequence (and alignments):
>> NP_001104303.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  376.9  10.9  6.4e-117  6.4e-117       1     332 []       9     341 ..       9     341 .. 0.83

  Alignments for each domain:
  == domain 1  score: 376.9 bits;  conditional E-value: 6.4e-117
          DUF572   1 kYyPPDfdpskipalrekarlknrqlvvRlmaPfnmrCktCgeyIykGvkFNarKekVgnetYlgipIfrFyikCtrClneitfkTDPkntdYvv 95 
                     kYyPPDfdpskip  + k++ k+rq+vvRlmaPfnmrCktCgeyIykG+kFNarKe+V+ne Ylg+pIfrFyikCtrCl+eitfkTDP+ntdY++
  NP_001104303.1   9 KYYPPDFDPSKIP--KLKLP-KDRQYVVRLMAPFNMRCKTCGEYIYKGKKFNARKETVQNELYLGLPIFRFYIKCTRCLAEITFKTDPENTDYAM 100
                     9************..*****.************************************************************************** PP

          DUF572  96 eeGatRnfkaekleeeeakreekekeeeeaedamkklEkrtkdskkemealesLeeLqelnqrqakvdfdanlelrkefreekkereeeeedeea 190
                     e+GatRnf+aekl+eee+k+ ++e+e+ee +++mk+lE+rt dsk eme+le+L+eL+elnqrqa+vdf+ +l ++ke ++++k+re+ee de++
  NP_001104303.1 101 EHGATRNFQAEKLIEEEEKKIQQEREDEELNNPMKVLENRTRDSKLEMEVLENLQELKELNQRQAQVDFEGMLGQYKELEQRQKQREQEE-DEQE 194
                     ****************************************************************************************99.**** PP

          DUF572 191 lkekislekikllpedeedekkaklle.gkteslfasseesaksakk.kptkk..esskekkkeslekklskltkkkadsslvvrKkkkeeeksk 281
                     +ke ++ + +k+l++ + + ++a+  +  +++++++ +++  +  ++ ++t++   ss+ +kk+s++++++ l+ k a+ slvvrKk+++ ++sk
  NP_001104303.1 195 TKEMLERALVKRLRDSDSE-EEAENAKeRSKKHIAD-KPT--DILTTdTSTSSqgLSSAVAKKQSWDRSVGGLSVKGALGSLVVRKKPAD-SASK 284
                     **66644489999776633.4454444233332322.222..2222222221135888999***************************99.5566 PP

          DUF572 282 eskekteeeskeseeeskkeeetsaee.ekee.....kakkkssslsllvaysdsdd 332
                     +s+ ++  +++ + +++ + + +s+++ ++ +      + ++ ssl+ll+aysdsdd
  NP_001104303.1 285 PSHAAPPPAAAAAGTQTGAVKPESSITsSSASsniqpVSCQNGSSLGLLGAYSDSDD 341
                     66665555555555544444444444433333567677788899***********97 PP



Or compare NP_001104303.1 to CDD or PaperBLAST