PaperBLAST – Find papers about a protein or its homologs

 

Align NP_611092.2 to PF04502 (DUF572)

NP_611092.2 has 333 amino acids

Query:       DUF572  [M=332]
Accession:   PF04502.13
Description: Family of unknown function (DUF572)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
   2.7e-111  358.4  14.5   3.1e-111  358.2  14.5    1.0  1  NP_611092.2  


Domain annotation for each sequence (and alignments):
>> NP_611092.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  358.2  14.5  3.1e-111  3.1e-111       1     332 []       9     330 ..       9     330 .. 0.81

  Alignments for each domain:
  == domain 1  score: 358.2 bits;  conditional E-value: 3.1e-111
       DUF572   1 kYyPPDfdpskipalrekarlknrqlvvRlmaPfnmrCktCgeyIykGvkFNarKekVgnetYlgipIfrFyikCtrClneitfkTDPkntdYvveeG 98 
                  kYyPPDfdpskip  r+k++ knrq++vRlmaPfnmrCktCgeyIykG+kFNarKe+V+netYlgi+I+rFyikCtrCl+ei+fkTDP+ntdY++e+G
  NP_611092.2   9 KYYPPDFDPSKIP--RMKLA-KNRQYTVRLMAPFNMRCKTCGEYIYKGKKFNARKEDVENETYLGIRIYRFYIKCTRCLQEISFKTDPQNTDYEIEAG 103
                  9************..*****.***************************************************************************** PP

       DUF572  99 atRnfkaekleeeeakreekekeeeeaedamkklEkrtkdskkemealesLeeLqelnqrqakvdfdanlelrk..efreekkereeeeedeealkek 194
                  atRnf+a kl+ee+a+ree+e ++eea+++mk lE+rt++s++e+e++esLeeL++ln+rq++vd+++ l++++  e+++e++eree+e de+++k +
  NP_611092.2 104 ATRNFMALKLAEEQARREEQELRDEEANNPMKLLENRTQQSRNEIETIESLEELRDLNRRQQTVDYNTLLQQYNtvETERERQEREERE-DEDFIK-S 199
                  **************************************************************************444555555555555.777888.8 PP

       DUF572 195 islekikllpedeedekkaklle.gkteslfasseesaksakkkpt.kkesskekkkeslekklskltkkkadsslvvrKkkkeeekskeskekteee 290
                  +   + k  pe +     ++ +e  k+e+l+  s+++ ++++ kp+ +   s +++++s+ ++ ++ +k+k+   lv+ K ++ ++ + ++ +++ e+
  NP_611092.2 200 V---NFKNKPEGSSRVVAEEIIEeIKDEPLDTPSAPPPAKQA-KPStI---SLSATSSSKASAAQSMVKRKTPLVLVKPKATAVAKPTVATGTTQVES 290
                  8...44666666666666667777777777776666544332.44424...45555666666666666677778888888887755555555555555 PP

       DUF572 291 skeseeeskkeeetsaeeekeekakkkssslsllvaysdsdd 332
                  +  +++ s    + +ae++++++ +++ ++lsll+aysds++
  NP_611092.2 291 KPAATTPSVV--SAPAETKATNQPAAAPAGLSLLAAYSDSSE 330
                  5544444443..334444666678899*************96 PP



Or compare NP_611092.2 to CDD or PaperBLAST