Q7LE05 has 41 amino acids
Query: Saf4_Yju2 [M=333]
Accession: PF04502.17
Description: Saf4/Yju2 protein
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.3e-20 58.1 5.3 6.8e-20 58.0 5.3 1.0 1 Q7LE05
Domain annotation for each sequence (and alignments):
>> Q7LE05
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 58.0 5.3 6.8e-20 6.8e-20 1 33 [. 9 41 .] 9 41 .] 0.99
Alignments for each domain:
== domain 1 score: 58.0 bits; conditional E-value: 6.8e-20
Saf4_Yju2 1 kYyPPDfDpskiprerarknrqlvvRlmaPfni 33
kYyPPDfDpskip+ +++k+rq+vvRlmaPfn+
Q7LE05 9 KYYPPDFDPSKIPKLKLPKDRQYVVRLMAPFNM 41
9*******************************9 PP
Or compare Q7LE05 to CDD or PaperBLAST