PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::O60141 to PF04502 (DUF572)

SwissProt::O60141 has 299 amino acids

Query:       DUF572  [M=332]
Accession:   PF04502.13
Description: Family of unknown function (DUF572)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    2.3e-57  181.1   5.4    2.9e-57  180.8   5.4    1.1  1  SwissProt::O60141  


Domain annotation for each sequence (and alignments):
>> SwissProt::O60141  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  180.8   5.4   2.9e-57   2.9e-57       1     223 [.       8     239 ..       8     292 .. 0.79

  Alignments for each domain:
  == domain 1  score: 180.8 bits;  conditional E-value: 2.9e-57
             DUF572   1 kYyPPDfdpskipalrekarlknrqlvvRlmaPfnmrCktCgeyIykGvkFNarKekVgnetYlgipIfrFyikCtrClneitfkTDPkntd 92 
                        kY+PP+   +k +         +   v+R+++Pf ++C++C+++I +G++FNa K+++g   Y++++I++F+ kC+ C+n i ++TDPknt+
  SwissProt::O60141   8 KYIPPEGPNAKRK--FD-----KLRNVIRFEMPFPVWCNNCENIIQQGTRFNAVKKEIGS--YYTTKIWSFSLKCHLCSNPIDVHTDPKNTE 90 
                        7888887755544..33.....44479*********************************..****************************** PP

             DUF572  93 YvveeGatRnfkaekleeeeakreekekeeeeaedamkklEkrtkdskkemealesLeeLqelnqrqakvdfdanlelrkefreekkereee 184
                        Y v +G++R+ +++   e+ ak e++ek     +da+++lE + +++k e+   + ++ + e n+r + ++f ++++lrk+fre+kk  +++
  SwissProt::O60141  91 YIVASGGRRKIEPQDINERPAKAENDEKVP---SDAIEALETQLTQQKSEKHNSSVINFIYEKNERLWSDPFVSSQRLRKQFRERKKIEKKQ 179
                        *********999999888887777777766...*********************************************************** PP

             DUF572 185 eedeealkekislekikllpedeedekkakllegkte.......................sl 223
                        e+++  lk+++ l +i++lp  + d++ka ll   +e                       s+
  SwissProt::O60141 180 EAKDLSLKNRAAL-DIDILPPSSSDKDKALLLLD-NElgknkfirkldyrrtlmpssrtfST 239
                        ***********88.9****998877666655443.323466777777777766666644422 PP



Or compare SwissProt::O60141 to CDD or PaperBLAST