PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q9BW85 to PF04502 (DUF572)

SwissProt::Q9BW85 has 323 amino acids

Query:       DUF572  [M=332]
Accession:   PF04502.13
Description: Family of unknown function (DUF572)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
   1.4e-115  372.5   7.8   1.7e-115  372.3   7.8    1.0  1  SwissProt::Q9BW85  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q9BW85  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  372.3   7.8  1.7e-115  1.7e-115       1     332 []       9     318 ..       9     318 .. 0.85

  Alignments for each domain:
  == domain 1  score: 372.3 bits;  conditional E-value: 1.7e-115
             DUF572   1 kYyPPDfdpskipalrekarlknrqlvvRlmaPfnmrCktCgeyIykGvkFNarKekVgnetYlgipIfrFyikCtrClneitfkTDPkntd 92 
                        kYyPPDfdpskip  + k++ k+rq+vvRlmaPfnmrCktCgeyIykG+kFNarKe+V+ne Ylg+pIfrFyikCtrCl+eitfkTDP+ntd
  SwissProt::Q9BW85   9 KYYPPDFDPSKIP--KLKLP-KDRQYVVRLMAPFNMRCKTCGEYIYKGKKFNARKETVQNEVYLGLPIFRFYIKCTRCLAEITFKTDPENTD 97 
                        9************..*****.*********************************************************************** PP

             DUF572  93 YvveeGatRnfkaekleeeeakreekekeeeeaedamkklEkrtkdskkemealesLeeLqelnqrqakvdfdanlelrkefreekkereee 184
                        Y++e+GatRnf+aekl eee+kr +ke+e+ee +++mk+lE+rtkdsk eme+le+L+eL++lnqrqa+vdf+a+l++++ ++ee++++++e
  SwissProt::Q9BW85  98 YTMEHGATRNFQAEKLLEEEEKRVQKEREDEELNNPMKVLENRTKDSKLEMEVLENLQELKDLNQRQAHVDFEAMLRQHRLSEEERRRQQQE 189
                        ********************************************************************************999999999999 PP

             DUF572 185 eedeealkekislekikllpedeedekkakllegkteslfasseesaksakkkpt.kk..esskekkkeslekklskltkkkadsslvvrKk 273
                        e de+++++ ++ +++++l ed+++e++a+                + + +++pt ++    + ++k e +e+++++l +++ +s lvv+Kk
  SwissProt::Q9BW85 190 E-DEQETAALLEEARKRRLLEDSDSEDEAAPSPL------------QPALRPNPTaILdeAPKPKRKVEVWEQSVGSLGSRPPLSRLVVVKK 268
                        8.99999977755599999998888555533222............12222233322233557899************************** PP

             DUF572 274 kkeeekskeskekteeeskeseeeskkeeetsaeeekeekakkkssslsllvaysdsdd 332
                        +k+ ++ +  + +++++ +  +++++       +e++++  ++ +ssls+l+ay dsdd
  SwissProt::Q9BW85 269 AKADPDCS--NGQPQAAPTPGAPQNR-------KEANPTPLTPGASSLSQLGAYLDSDD 318
                        *9933322..2222222222222222.......22345577899*************97 PP



Or compare SwissProt::Q9BW85 to CDD or PaperBLAST