PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10080032 to PF04502 (DUF572)

VIMSS10080032 has 331 amino acids

Query:       DUF572  [M=332]
Accession:   PF04502.13
Description: Family of unknown function (DUF572)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
   4.9e-100  321.4  15.1   5.8e-100  321.2  15.1    1.0  1  VIMSS10080032  


Domain annotation for each sequence (and alignments):
>> VIMSS10080032  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  321.2  15.1  5.8e-100  5.8e-100       1     298 [.       9     315 ..       9     329 .. 0.84

  Alignments for each domain:
  == domain 1  score: 321.2 bits;  conditional E-value: 5.8e-100
         DUF572   1 kYyPPDfdpskipalrekarlknrqlvvRlmaPfnmrCktCgeyIykGvkFNarKekVgnetYlgipIfrFyikCtrClneitfkTDPkntdYvve 96 
                    kYyPPDfdp+k++  r +++ kn+q++vR+m+P+++rC tCg+yIykG+kFN+rKe+V +etYlgi+IfrFy+kCt+C++e+t+kTDP+n+dY ve
  VIMSS10080032   9 KYYPPDFDPAKLQ--RLRRP-KNQQIKVRMMLPMSVRCGTCGNYIYKGTKFNSRKEDVIGETYLGIQIFRFYFKCTKCSAELTMKTDPQNSDYIVE 101
                    9************..*****.*************************************************************************** PP

         DUF572  97 eGatRnfkaekleeeeakreekekeeeeaedamkklEkrtkdskkemealesLeeLqelnqrqakvdfdanlelrkefreekkereeeeedeealk 192
                    +Ga+Rn++++++e+ee++++++++++ee++damk+lE+rt dsk+em+++++L+e++++++r+a+v++da+le+++++ +ek +r eee de+ +k
  VIMSS10080032 102 SGASRNYEPWRAEDEEVDKDKQKRDAEEMGDAMKSLENRTLDSKREMDIIAALDEMKSMKSRHATVSVDAMLEALQRTGAEKVKRIEEE-DEAVIK 196
                    ****************************************************************************************9.****** PP

         DUF572 193 ekisle..kikllpede.edekkaklle.gkte.......slfasseesaksakkkptkk.........esskekkkeslekklskltkkkadssl 268
                    + ++ +   i+++ ++e +d+ +++ ++ + +        s + s++++a+++      +         +ss+e+ ke +++++sk+   k+ +  
  VIMSS10080032 197 SIFGKQkeVIRRIADEEiDDDYDDDDIDdYPSLqkekkgsSSDLSKKRKATEV------SpsnptdiltSSSAENPKEPKKQAISKQ-PFKSVHIK 285
                    66644456999999988888888888886666333333333333333333333......1344555667788888888888998887.66677899 PP

         DUF572 269 vvrKkkkeeekskeskekteeeskeseees 298
                    v++K+++++++s+++  k+ee++++ ++++
  VIMSS10080032 286 VIKKQPQPTSSSTPAPAKPEEKKSDGAANT 315
                    999999997777777666666666555443 PP



Or compare VIMSS10080032 to CDD or PaperBLAST