PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10080963 to PF04502 (DUF572)

VIMSS10080963 has 310 amino acids

Query:       DUF572  [M=332]
Accession:   PF04502.13
Description: Family of unknown function (DUF572)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    8.1e-70  222.1   2.8    9.1e-70  221.9   2.8    1.0  1  VIMSS10080963  


Domain annotation for each sequence (and alignments):
>> VIMSS10080963  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  221.9   2.8   9.1e-70   9.1e-70       2     264 ..      13     278 ..      12     309 .. 0.80

  Alignments for each domain:
  == domain 1  score: 221.9 bits;  conditional E-value: 9.1e-70
         DUF572   2 YyPPDfdpski........palrekar.lknrqlvvRlmaPfnmrCktCgeyIykGvkFNarKekVgnetYlgipIfrFyikCtrClneitfkTDP 88 
                    YyPP++ p++         ++lre+a+ + +++lv+R+++P+n++C +C   I+kGv+FNa+K++Vgn  Y++++I++F +k + C+ ei+++TDP
  VIMSS10080963  13 YYPPEWTPDQGslnkfqgqHPLRERAKkIGEGILVIRFEMPYNIWCGGCSSMIAKGVRFNAEKKQVGN--YYSTKIWSFAMKSPCCKHEIVIQTDP 106
                    *********999*******99******999**************************************..************************** PP

         DUF572  89 kntdYvveeGatRnfkaekleeeeakreekekeeeeaedamkklEkrtkdskkemealesLeeLqelnqrqakvdfdanlelrkefreekkereee 184
                    +n++Yv+++Ga+++ ++ ++e+ e  +  +e+e+ +  d++++lE++  d +k+++a + L  Lq +++ +  +d++ n +lr++ r+++k+  ee
  VIMSS10080963 107 QNCEYVITSGAQKKVEEYEAEDAETMELTAEQEKGKLADPFYRLEHQEVDLQKKKAAEPLLVRLQRVSDARHADDYSLNKALRAQLRRHRKRVAEE 202
                    *************888888888888888888888899******************************************************99999 PP

         DUF572 185 eedeealkekislekikllpedeedekkakllegkte...............slfasseesaksakkkptkk...esskekkkeslekklskltkk 262
                    e    a + k++l  i+llp+ eed k a+ +++k++               s+                     + s++kk+ +le k +k + +
  VIMSS10080963 203 E---TASR-KLGL-GIRLLPKSEEDIKAASNVKFKSKfdknrkdkralihasSI-----------------FpesSYSSSKKRMELEAKRRKISAA 276
                    8...4444.5656.99**************999777522222222222222211.................1222333444444444444444222 PP

         DUF572 263 ka 264
                    +a
  VIMSS10080963 277 SA 278
                    22 PP



Or compare VIMSS10080963 to CDD or PaperBLAST