PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10090245 to PF04502 (DUF572)

VIMSS10090245 has 254 amino acids

Query:       DUF572  [M=332]
Accession:   PF04502.13
Description: Family of unknown function (DUF572)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    7.4e-64  202.5  13.7    8.8e-64  202.2  13.7    1.0  1  VIMSS10090245  


Domain annotation for each sequence (and alignments):
>> VIMSS10090245  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  202.2  13.7   8.8e-64   8.8e-64       1     234 [.       9     226 ..       9     250 .. 0.84

  Alignments for each domain:
  == domain 1  score: 202.2 bits;  conditional E-value: 8.8e-64
         DUF572   1 kYyPPDfdpskipalrekarlknrqlvvRlmaPfnmrCktCgeyIykGvkFNarKekVgnetYlgipIfrFyikCtrClneitfkTDPkntdYvve 96 
                    kYyPP fdp++ip  r +++ kn+q ++R m+P  +rC+tCg+y  +G+k N r e+V +etYlgi+I rFy+kC++C  e+ +kTDPkn+ Yv e
  VIMSS10090245   9 KYYPPNFDPKQIP--RIRKP-KNQQRKIRSMVPLRIRCNTCGNYMSEGTKINCREENVIGETYLGIKIHRFYFKCSKCCTELILKTDPKNSSYVAE 101
                    9************..*****.*************************************************************************** PP

         DUF572  97 eGatRnfkaekleeeeakreekekeeeeaedamkklEkrtkdskkemealesLeeLqelnqrqakvdfdanlelrkefreekkereeeeedeealk 192
                    +Gat  +++++          +e+++e+ +d m +lEkrt  sk+e +++++L+e++++++r+  v++d++le + + ++e++e  +ee d++++k
  VIMSS10090245 102 SGATCVYDQHE----------EEEQAEDGGDRMSSLEKRTLVSKREVDVMAALDEMKSMKSRRVSVSVDSMLEDLSKRHKEEEEVAKEE-DAALIK 186
                    *****776664..........222334569**********************************************9999999999998.999999 PP

         DUF572 193 ekisle.kikllpedeedekkaklle.gkteslfasseesaksa 234
                     +++   + ++++e++++ +k k ++       ++++++++k a
  VIMSS10090245 187 -STKFGkQRRIVDEETDEMEKTKKVRmEAV---DEKKPKTKKLA 226
                    .66566355555666577666666663333...33333333333 PP



Or compare VIMSS10090245 to CDD or PaperBLAST