PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10096391 to PF04502 (DUF572)

VIMSS10096391 has 249 amino acids

Query:       DUF572  [M=332]
Accession:   PF04502.13
Description: Family of unknown function (DUF572)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    5.6e-69  219.3  20.3    6.7e-69  219.1  20.3    1.0  1  VIMSS10096391  


Domain annotation for each sequence (and alignments):
>> VIMSS10096391  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  219.1  20.3   6.7e-69   6.7e-69       1     233 [.       9     220 ..       9     247 .. 0.82

  Alignments for each domain:
  == domain 1  score: 219.1 bits;  conditional E-value: 6.7e-69
         DUF572   1 kYyPPDfdpskipalrekarlknrqlvvRlmaPfnmrCktCgeyIykGvkFNarKekVgnetYlgipIfrFyikCtrClneitfkTDPkntdYvve 96 
                    kYyPPDfdp+ki+  r k++ kn+q ++R+m+P  +rC+tCg+y  +G+kFN r e+V  etYlg++I rFyikCt+Cl+e+t+kTDPkn  Y+ve
  VIMSS10096391   9 KYYPPDFDPKKIH--RIKKP-KNQQKKIRFMLPVRVRCNTCGNYMSEGTKFNCRQEDVITETYLGLKIHRFYIKCTKCLAELTIKTDPKNHSYTVE 101
                    9************..*****.*************************************************************************** PP

         DUF572  97 eGatRnfkaekleeeeakreekekeeeeaedamkklEkrtkdskkemealesLeeLqelnqrqakvdfdanlelrkefreekkereeeeedeealk 192
                    +Ga+  ++ ++ +eee    +k+k     e+a+++lE+rt  sk+e+e+++sL+eL+++++r+a  ++d +le +     ++k++eee+ +ee+l 
  VIMSS10096391 102 SGASCLYNGHEDIEEE----KKKKH----ENALESLENRTVVSKREIEVMASLDELKSMKSRRASLSVDYMLEDLS----RRKKQEEENVEEELLI 185
                    *****9*999988888....55553....6*******************************************998....4444444444555555 PP

         DUF572 193 ekislekikllpedeedekkakllegkteslfasseesaks 233
                    ++i+    k+++ dee++k+ ++++ k++    ++++++k+
  VIMSS10096391 186 KSIKF--GKRIRTDEEKKKNYEAFDEKKK----KKKKPKKR 220
                    58844..7888888877666666553332....11122221 PP



Or compare VIMSS10096391 to CDD or PaperBLAST