PaperBLAST – Find papers about a protein or its homologs

 

Align NP_565602.1 to PF04504 (DUF573)

NP_565602.1 has 386 amino acids

Query:       DUF573  [M=95]
Accession:   PF04504.14
Description: Protein of unknown function, DUF573
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    7.1e-33   99.5   0.2    3.6e-32   97.2   0.2    2.3  1  NP_565602.1  


Domain annotation for each sequence (and alignments):
>> NP_565602.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   97.2   0.2   3.6e-32   3.6e-32       2      95 .]      66     159 ..      65     159 .. 0.99

  Alignments for each domain:
  == domain 1  score: 97.2 bits;  conditional E-value: 3.6e-32
       DUF573   2 qrlWseeDEielLqglldfksktgtspksdldafyeavksslssdvsksqlseKlrrLkkkyrnavskikkgkdpsfkkphdrklfelskkiWg 95 
                   r+W+eeDE+++L+gl+d+++ktg +pk d+dafy ++ ss+ +++sk+q+ +K+r+Lk++++ +++ki++g+dp+f++++d+++f +s++iWg
  NP_565602.1  66 VRIWNEEDELSILKGLVDYRAKTGFNPKIDWDAFYSFLGSSIVAKFSKEQVLSKIRKLKRRFHVHWEKISEGNDPKFTRSSDSEAFGFSSMIWG 159
                  59*******************************************************************************************8 PP



Or compare NP_565602.1 to CDD or PaperBLAST