PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::P0DKL0 to PF04504 (DUF573)

SwissProt::P0DKL0 has 301 amino acids

Query:       DUF573  [M=95]
Accession:   PF04504.14
Description: Protein of unknown function, DUF573
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    7.3e-31   93.1   0.6    7.3e-31   93.1   0.6    3.0  4  SwissProt::P0DKL0  


Domain annotation for each sequence (and alignments):
>> SwissProt::P0DKL0  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -3.3   2.0      0.81      0.81      71      81 ..      41      51 ..      25      58 .. 0.43
   2 !   93.1   0.6   7.3e-31   7.3e-31       2      94 ..      62     154 ..      61     155 .. 0.98
   3 ?   -1.8   0.0      0.29      0.29       4      19 ..     178     193 ..     176     212 .. 0.61
   4 ?    0.2   0.1      0.07      0.07      27      56 ..     220     249 ..     198     275 .. 0.59

  Alignments for each domain:
  == domain 1  score: -3.3 bits;  conditional E-value: 0.81
             DUF573 71 kkgkdpsfkkp 81
                       +++k+++ k++
  SwissProt::P0DKL0 41 ETKKKKKKKTK 51
                       22222222222 PP

  == domain 2  score: 93.1 bits;  conditional E-value: 7.3e-31
             DUF573   2 qrlWseeDEielLqglldfksktgtspksdldafyeavksslssdvsksqlseKlrrLkkkyrnavskikkgkdpsfkkphdrklfelskki 93 
                        +r+W+eeDE+++L+gl+df++ktg ++k d+dafy +vk+s++++vsk ql++K r+Lkkk+   ++ki++g+dp+f+++++ ++f  s +i
  SwissProt::P0DKL0  62 NRIWNEEDELSILKGLVDFRAKTGLESKIDWDAFYCYVKGSIHVKVSKCQLMSKTRKLKKKFLDQMEKIDQGNDPHFTRSSETEAFGYSMMI 153
                        69************************99**************************************************************** PP

             DUF573  94 W 94 
                        W
  SwissProt::P0DKL0 154 W 154
                        * PP

  == domain 3  score: -1.8 bits;  conditional E-value: 0.29
             DUF573   4 lWseeDEielLqglld 19 
                        ++ e++E++l+ + ++
  SwissProt::P0DKL0 178 VFEEDEEVALIDKGAA 193
                        5677777777765444 PP

  == domain 4  score: 0.2 bits;  conditional E-value: 0.07
             DUF573  27 spksdldafyeavksslssdvsksqlseKl 56 
                        ++ +d d++  av++ +++ +  + ls+  
  SwissProt::P0DKL0 220 ESDDDDDDVLCAVRDAFETTMMSQGLSDYQ 249
                        333677777777777777644444443322 PP



Or compare SwissProt::P0DKL0 to CDD or PaperBLAST