PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q94IK2 to PF04504 (DUF573)

SwissProt::Q94IK2 has 399 amino acids

Query:       DUF573  [M=95]
Accession:   PF04504.14
Description: Protein of unknown function, DUF573
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.1e-30   92.5   0.2    1.1e-30   92.5   0.2    2.8  2  SwissProt::Q94IK2  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q94IK2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   92.5   0.2   1.1e-30   1.1e-30       3      95 .]     158     247 ..     156     247 .. 0.97
   2 ?   -1.6   0.4      0.26      0.26      80      84 ..     288     292 ..     261     335 .. 0.64

  Alignments for each domain:
  == domain 1  score: 92.5 bits;  conditional E-value: 1.1e-30
             DUF573   3 rlWseeDEielLqglldfksktgtspksdldafyeavksslssdvsksqlseKlrrLkkkyrnavskikkgkdpsfkkphdrklfelskkiW 94 
                         lWs++D+++lL+g+l++k+ +g +p+ d++af+e+++++l+++vsksq+s+K+rrLkkk+ ++v+    g++p fkk +d  +fe sk+iW
  SwissProt::Q94IK2 158 SLWSDDDQLALLKGILEYKTVKGMEPSADMSAFHEFIRGKLQAEVSKSQISDKVRRLKKKFLTNVKD---GEEPVFKKGQDFLIFEHSKRIW 246
                        58*************************************************************9975...9********************* PP

             DUF573  95 g 95 
                        g
  SwissProt::Q94IK2 247 G 247
                        8 PP

  == domain 2  score: -1.6 bits;  conditional E-value: 0.26
             DUF573  80 kphdr 84 
                        kp+d 
  SwissProt::Q94IK2 288 KPKDD 292
                        22222 PP



Or compare SwissProt::Q94IK2 to CDD or PaperBLAST