PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10079389 to PF04504 (DUF573)

VIMSS10079389 has 352 amino acids

Query:       DUF573  [M=95]
Accession:   PF04504.14
Description: Protein of unknown function, DUF573
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    1.2e-35  108.3   0.5    1.2e-35  108.3   0.5    3.0  4  VIMSS10079389  


Domain annotation for each sequence (and alignments):
>> VIMSS10079389  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.5   0.1      0.47      0.47      48      51 ..      71      74 ..      44     104 .. 0.60
   2 !  108.3   0.5   1.2e-35   1.2e-35       1      95 []     138     229 ..     138     229 .. 0.98
   3 ?   -2.2   0.1      0.39      0.39      43      43 ..     258     258 ..     237     291 .. 0.52
   4 ?    0.3   0.0     0.064     0.064      21      41 ..     299     321 ..     292     334 .. 0.65

  Alignments for each domain:
  == domain 1  score: -2.5 bits;  conditional E-value: 0.47
         DUF573 48 sksq 51
                   +k+q
  VIMSS10079389 71 KKDQ 74
                   2222 PP

  == domain 2  score: 108.3 bits;  conditional E-value: 1.2e-35
         DUF573   1 fqrlWseeDEielLqglldfksktgtspksdldafyeavksslssdvsksqlseKlrrLkkkyrnavskikkgkdpsfkkphdrklfelskkiWg 95 
                    fqrlW+e+DEi++Lqgl+d k++tg s   +++++ye vk+s+s+dvsk+ql+eKlr Lkkky+n++ k+k+g +p+f kphdrk+felsk +Wg
  VIMSS10079389 138 FQRLWTEDDEIVVLQGLIDDKKDTGVS---NTNKVYELVKKSISFDVSKNQLMEKLRALKKKYENNLGKAKDGVEPTFVKPHDRKAFELSKLVWG 229
                    89***********************96...9***************************************************************8 PP

  == domain 3  score: -2.2 bits;  conditional E-value: 0.39
         DUF573  43 l 43 
                    l
  VIMSS10079389 258 L 258
                    2 PP

  == domain 4  score: 0.3 bits;  conditional E-value: 0.064
         DUF573  21 ksktgts..pksdldafyeavks 41 
                    ++++g s  +++d++ fye+ k 
  VIMSS10079389 299 TAQQGLSklASKDMKRFYEQWKA 321
                    45555542234888888888765 PP



Or compare VIMSS10079389 to CDD or PaperBLAST