PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10084433 to PF04504 (DUF573)

VIMSS10084433 has 376 amino acids

Query:       DUF573  [M=95]
Accession:   PF04504.14
Description: Protein of unknown function, DUF573
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    1.2e-36  111.6   0.7    3.6e-36  110.1   0.7    1.9  1  VIMSS10084433  


Domain annotation for each sequence (and alignments):
>> VIMSS10084433  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  110.1   0.7   3.6e-36   3.6e-36       1      95 []     155     245 ..     155     245 .. 0.97

  Alignments for each domain:
  == domain 1  score: 110.1 bits;  conditional E-value: 3.6e-36
         DUF573   1 fqrlWseeDEielLqglldfksktgtspksdldafyeavksslssdvsksqlseKlrrLkkkyrnavskikkgkdpsfkkphdrklfelskkiWg 95 
                    fqrlWseeDEi +Lqg++dfk++tg+sp+ d++afy+++k+s+s++vsk+q+++K+r+L+kky  +  +    ++psf k+hd+k+felsk iWg
  VIMSS10084433 155 FQRLWSEEDEILVLQGMIDFKADTGKSPYVDTNAFYDFLKKSISFEVSKNQFMDKIRSLRKKYIGKEGR----NEPSFVKAHDKKAFELSKFIWG 245
                    89**************************************************************97766....89*******************8 PP



Or compare VIMSS10084433 to CDD or PaperBLAST