PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10090761 to PF04504 (DUF573)

VIMSS10090761 has 414 amino acids

Query:       DUF573  [M=95]
Accession:   PF04504.14
Description: Protein of unknown function, DUF573
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    6.2e-28   83.7   1.5    1.4e-27   82.6   1.5    1.6  1  VIMSS10090761  


Domain annotation for each sequence (and alignments):
>> VIMSS10090761  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   82.6   1.5   1.4e-27   1.4e-27       3      95 .]      61     153 ..      59     153 .. 0.97

  Alignments for each domain:
  == domain 1  score: 82.6 bits;  conditional E-value: 1.4e-27
         DUF573   3 rlWseeDEielLqglldfksktgtspksdldafyeavksslssdvsksqlseKlrrLkkkyrnavskikkgkdpsfkkphdrklfelskkiWg 95 
                     +Ws++DE+++L g++d++++t+ s  sd+da+y ++k+ +++++sk ql++K++++k+k++ ++ ++++g++ sf++++d ++f+ls  iW+
  VIMSS10090761  61 MNWSKNDELVILGGIVDYENETKLSYRSDWDALYRYIKDCVEAKFSKIQLINKVKNMKRKFTYNQGRSNHGEQLSFTNTDDDEIFKLSLIIWD 153
                    79*********************9866*****************************************************************6 PP



Or compare VIMSS10090761 to CDD or PaperBLAST