PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10098863 to PF04504 (DUF573)

VIMSS10098863 has 154 amino acids

Query:       DUF573  [M=95]
Accession:   PF04504.14
Description: Protein of unknown function, DUF573
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    4.6e-23   68.0   1.2    4.6e-23   68.0   1.2    1.6  2  VIMSS10098863  


Domain annotation for each sequence (and alignments):
>> VIMSS10098863  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.4   0.1      0.22      0.22      65      77 ..      26      38 ..      18      46 .. 0.43
   2 !   68.0   1.2   4.6e-23   4.6e-23       4      95 .]      46     135 ..      43     135 .. 0.97

  Alignments for each domain:
  == domain 1  score: -1.4 bits;  conditional E-value: 0.22
         DUF573 65 navskikkgkdps 77
                   ++vs  +++kd +
  VIMSS10098863 26 KNVSAKQSKKDAK 38
                   3333322333322 PP

  == domain 2  score: 68.0 bits;  conditional E-value: 4.6e-23
         DUF573   4 lWseeDEielLqglldfksktgtspksdldafyeavksslssdvsksqlseKlrrLkkkyrnavskikkgkdpsfkkphdrklfelskkiWg 95 
                     Ws++DE+ +Lqg+ldfks tg++p +d++  ye+v +++ s v  ++++eK+++Lkkk +++++    +kdps ++p  +k  e+ k+iWg
  VIMSS10098863  46 KWSSKDEVLVLQGMLDFKSVTGKNPVDDINGAYEFVVHEYISTVIDEDFIEKMKSLKKKLKKKQRI--YDKDPSSSEPLYQKSSEWLKMIWG 135
                    6************************************************************98765..89*********************8 PP



Or compare VIMSS10098863 to CDD or PaperBLAST