PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10098870 to PF04504 (DUF573)

VIMSS10098870 has 302 amino acids

Query:       DUF573  [M=95]
Accession:   PF04504.14
Description: Protein of unknown function, DUF573
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    1.1e-31   95.7   0.1    1.1e-31   95.7   0.1    2.5  3  VIMSS10098870  


Domain annotation for each sequence (and alignments):
>> VIMSS10098870  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.1   0.5      0.18      0.18      50      63 ..      43      56 ..      19      60 .. 0.56
   2 !   95.7   0.1   1.1e-31   1.1e-31       2      95 .]      65     158 ..      64     158 .. 0.99
   3 ?   -2.5   0.0      0.47      0.47      37      49 ..     240     252 ..     214     272 .. 0.54

  Alignments for each domain:
  == domain 1  score: -1.1 bits;  conditional E-value: 0.18
         DUF573 50 sqlseKlrrLkkky 63
                   ++ ++K  ++kkk 
  VIMSS10098870 43 EETMKKKMKMKKKK 56
                   33344444444443 PP

  == domain 2  score: 95.7 bits;  conditional E-value: 1.1e-31
         DUF573   2 qrlWseeDEielLqglldfksktgtspksdldafyeavksslssdvsksqlseKlrrLkkkyrnavskikkgkdpsfkkphdrklfelskkiWg 95 
                     r+W+eeDE+++L+gl+d+++ktg +pk d+daf+ ++ ss+  ++sk+q+ +K+r+Lk++++ +++ki++g+dp+f++++d+++f +s++iWg
  VIMSS10098870  65 VRIWNEEDELSILKGLVDYRAKTGFNPKIDWDAFCSFLGSSIVERFSKDQVLSKIRKLKRRFHVHSEKINQGNDPKFTRSSDSEAFGFSSMIWG 158
                    59*******************************************************************************************8 PP

  == domain 3  score: -2.5 bits;  conditional E-value: 0.47
         DUF573  37 eavksslssdvsk 49 
                    eav s+  s ++k
  VIMSS10098870 240 EAVMSQGLSGYQK 252
                    3333333333333 PP



Or compare VIMSS10098870 to CDD or PaperBLAST