PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10098888 to PF04504 (DUF573)

VIMSS10098888 has 364 amino acids

Query:       DUF573  [M=95]
Accession:   PF04504.14
Description: Protein of unknown function, DUF573
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    5.8e-36  109.4   2.1    5.8e-36  109.4   2.1    2.1  2  VIMSS10098888  


Domain annotation for each sequence (and alignments):
>> VIMSS10098888  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  109.4   2.1   5.8e-36   5.8e-36       1      95 []     157     247 ..     157     247 .. 0.97
   2 ?   -3.3   0.1      0.82      0.82      45      60 ..     263     278 ..     255     283 .. 0.54

  Alignments for each domain:
  == domain 1  score: 109.4 bits;  conditional E-value: 5.8e-36
         DUF573   1 fqrlWseeDEielLqglldfksktgtspksdldafyeavksslssdvsksqlseKlrrLkkkyrnavskikkgkdpsfkkphdrklfelskkiWg 95 
                    fqrlWs++DEi++Lqg++d++++tg+sp+ d++afye+ k+s+s++vsksq+s+K+r+L+kkyr++  k    ++p f k+hd+k+felsk iWg
  VIMSS10098888 157 FQRLWSDDDEISMLQGMIDYHADTGKSPSADTNAFYEFQKKSISFEVSKSQFSDKVRSLRKKYRAKEGK----DEPRFVKAHDKKAFELSKFIWG 247
                    89**************************************************************97765....89*******************8 PP

  == domain 2  score: -3.3 bits;  conditional E-value: 0.82
         DUF573  45 sdvsksqlseKlrrLk 60 
                    s++s s+ +eKl ++k
  VIMSS10098888 263 SKKSASKTKEKLDSVK 278
                    3444455555555544 PP



Or compare VIMSS10098888 to CDD or PaperBLAST