PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10105366 to PF04504 (DUF573)

VIMSS10105366 has 572 amino acids

Query:       DUF573  [M=95]
Accession:   PF04504.14
Description: Protein of unknown function, DUF573
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    2.3e-30   91.5   0.6    2.3e-30   91.5   0.6    2.6  3  VIMSS10105366  


Domain annotation for each sequence (and alignments):
>> VIMSS10105366  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -4.3   1.6         1         1      72      81 ..      42      51 ..      26      57 .. 0.43
   2 !   91.5   0.6   2.3e-30   2.3e-30       2      94 ..      62     154 ..      61     155 .. 0.98
   3 ?   -1.3   0.0      0.21      0.21      27      54 ..     220     247 ..     198     266 .. 0.57

  Alignments for each domain:
  == domain 1  score: -4.3 bits;  conditional E-value: 1
         DUF573 72 kgkdpsfkkp 81
                   ++k+++ k++
  VIMSS10105366 42 TKKKKKKKTK 51
                   2222233333 PP

  == domain 2  score: 91.5 bits;  conditional E-value: 2.3e-30
         DUF573   2 qrlWseeDEielLqglldfksktgtspksdldafyeavksslssdvsksqlseKlrrLkkkyrnavskikkgkdpsfkkphdrklfelskkiW 94 
                    +r+W+eeDE+++L+gl+df++ktg ++k d+dafy +vk+s++++vsk ql++K r+Lkkk+   ++ki++g+dp+f+++++ ++f  s +iW
  VIMSS10105366  62 NRIWNEEDELSILKGLVDFRAKTGLESKIDWDAFYCYVKGSIHVKVSKCQLMSKTRKLKKKFLDQMEKIDQGNDPHFTRSSETEAFGYSMMIW 154
                    69************************99***************************************************************** PP

  == domain 3  score: -1.3 bits;  conditional E-value: 0.21
         DUF573  27 spksdldafyeavksslssdvsksqlse 54 
                    ++ +d d++  av++ +++ +  + ls+
  VIMSS10105366 220 ESDDDDDDVLCAVRDAFETTMMSQGLSD 247
                    3336677777777777776444443333 PP



Or compare VIMSS10105366 to CDD or PaperBLAST