M8BCR3 has 204 amino acids
Query: CASP_dom [M=151] Accession: PF04535.16 Description: Casparian strip membrane protein domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-42 131.3 4.3 1.7e-42 130.9 4.3 1.2 1 M8BCR3 Domain annotation for each sequence (and alignments): >> M8BCR3 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 130.9 4.3 1.7e-42 1.7e-42 3 151 .] 30 169 .. 28 169 .. 0.96 Alignments for each domain: == domain 1 score: 130.9 bits; conditional E-value: 1.7e-42 CASP_dom 3 klrlaelvLRllalvlalaaavvmatnkqtkevfkiqkkakfsdlpafrylvvanaiaavYsllqlvlsvvslvrkkserskalalllfilDqvlayllls 103 ++r +e +LR++ l l++aa++vm ++qt+e +++++sdl f+ylv+an+++a+Ysl++++ ++v + + ++ +++f+lDqv++yl+l+ M8BCR3 30 RVRPLETLLRAAPLGLCVAAMAVMLRDTQTNEY----GTVSYSDLGGFKYLVYANGLCAAYSLVSAFYTAVPR-----PATLSRSWIVFLLDQVFTYLILA 121 6778999***********************999....8********************************866.....777789***************** PP CASP_dom 104 AasAaaavvylakkgnseaqWlkiCnqfgkFcnrvaaavalsflafll 151 A +A+a+ yla++g++e++W+++C +fg Fc++++++va++f ++++ M8BCR3 122 AGAASAELLYLAYNGDKEVTWSEACGVFGGFCRQARTSVAITFGSVVC 169 *******************************************99986 PP
Or compare M8BCR3 to CDD or PaperBLAST