PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001131228.1 to PF04535 (DUF588)

NP_001131228.1 has 213 amino acids

Query:       DUF588  [M=150]
Accession:   PF04535.12
Description: Domain of unknown function (DUF588)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    3.7e-41  126.6   7.7    5.9e-41  125.9   7.7    1.3  1  NP_001131228.1  


Domain annotation for each sequence (and alignments):
>> NP_001131228.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  125.9   7.7   5.9e-41   5.9e-41       3     150 .]      38     177 ..      36     177 .. 0.96

  Alignments for each domain:
  == domain 1  score: 125.9 bits;  conditional E-value: 5.9e-41
          DUF588   3 klrvaelvLRlaavvlalaaavvmatnkqtkevfkiqveakfsdlpafvylvvanaiaavYsllqlvlsvvslvrkkersaalalllfllDqvla 97 
                     ++r +e +LR+a ++l++aa++vm  n+q++e     +++ +sdl  f+ylv+an+++a+Ysl++++ ++v      + + ++ +l+fllDqv++
  NP_001131228.1  38 RVRPVETLLRAAPLGLCVAAMTVMLRNQQSNEY----GAVAYSDLGGFKYLVYANGLCAAYSLVSAFYTAVPR----PATVSRSWLVFLLDQVFT 124
                     678899***********************9888....9********************************866....89999************* PP

          DUF588  98 ylllsAasAaaavvylakkgnseaqWlkiCnqfgkFcervaaavalsflafll 150
                     yl+l+A +Aaa+  yla++g++e++W+++C +fg+Fc++++++va++f ++l+
  NP_001131228.1 125 YLILAAGAAAAELLYLAYNGDKEVTWSEACGVFGSFCRQARTSVAITFGTVLC 177
                     ************************************************98875 PP



Or compare NP_001131228.1 to CDD or PaperBLAST