SwissProt::A1XGB4 has 166 amino acids
Query: CASP_dom [M=151] Accession: PF04535.16 Description: Casparian strip membrane protein domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-29 88.2 2.9 3.5e-29 87.7 2.9 1.1 1 SwissProt::A1XGB4 Domain annotation for each sequence (and alignments): >> SwissProt::A1XGB4 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 87.7 2.9 3.5e-29 3.5e-29 7 151 .] 13 150 .. 9 150 .. 0.96 Alignments for each domain: == domain 1 score: 87.7 bits; conditional E-value: 3.5e-29 CASP_dom 7 aelvLRllalvlalaaavvmatnkqtkevfkiqkkakfsdlpafrylvvanaiaavYsllqlvlsvvslvrkkserskalalllfilDqvla 98 ++l+ R+l+l+ l++++v+atn+qt++++ + +k kf+d+ a+ryl++ +i ++Y+llq+++s+ l+++++ + +l++f +D ++ SwissProt::A1XGB4 13 VSLIVRILTLICLLISFIVIATNNQTVSTVAGDVKIKFKDFYAYRYLIATVIIGMAYTLLQIAFSISLLTTGNRIGGEGFLLFDFYGDKFIS 104 689********************************************************************99999999************* PP CASP_dom 99 ylllsAasAaaavvylakkgnseaqWlkiCnqfgkFcnrvaaavalsflafll 151 y l+++a+A++++++ +k+ + + +++ kF n +aa++l +++f++ SwissProt::A1XGB4 105 YFLVTGAAASFGMTQDLKQLEGS-------DNYSKFLNTSNAAASLCLIGFFF 150 *****************999666.......9***************9999985 PP
Or compare SwissProt::A1XGB4 to CDD or PaperBLAST