PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::P0DKC2 to PF04535 (DUF588)

SwissProt::P0DKC2 has 186 amino acids

Query:       DUF588  [M=150]
Accession:   PF04535.12
Description: Domain of unknown function (DUF588)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.4e-49  153.9   6.8    1.8e-49  153.6   6.8    1.1  1  SwissProt::P0DKC2  


Domain annotation for each sequence (and alignments):
>> SwissProt::P0DKC2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  153.6   6.8   1.8e-49   1.8e-49       2     148 ..      23     169 ..      22     171 .. 0.97

  Alignments for each domain:
  == domain 1  score: 153.6 bits;  conditional E-value: 1.8e-49
             DUF588   2 rklrvaelvLRlaavvlalaaavvmatnkqtkevf..kiqveakfsdlpafvylvvanaiaavYsllqlvlsvvslvrkkersaalalllfl 91 
                        r+++v++++LRl+avv++la+a+ m+t+++++++f  +i+++a+++dlp+++ +vva+a a++Y +l+l+ls+ +++r  +++++ +++l++
  SwissProt::P0DKC2  23 RAVSVLDFILRLIAVVATLASAIAMGTTDESLPFFtqFIRFRAEYDDLPTLRLFVVASAFASGYLILSLPLSILHITR--SSARRTRVILII 112
                        78999***********************************************************************99..667779****** PP

             DUF588  92 lDqvlaylllsAasAaaavvylakkgnseaqWlkiCnqfgkFcervaaavalsflaf 148
                        lD+v+++ l++A+sAaaa+vyla+kgn +a+W ++C+q+++Fcer++++++ sf+a+
  SwissProt::P0DKC2 113 LDMVMLTSLTAASSAAAAIVYLAHKGNAKANWFAFCQQYDSFCERISGSLIGSFIAI 169
                        *******************************************************96 PP



Or compare SwissProt::P0DKC2 to CDD or PaperBLAST