PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q3EB59 to PF04535 (DUF588)

SwissProt::Q3EB59 has 212 amino acids

Query:       DUF588  [M=150]
Accession:   PF04535.12
Description: Domain of unknown function (DUF588)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
      3e-41  126.9   7.6    3.9e-41  126.5   7.6    1.1  1  SwissProt::Q3EB59  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q3EB59  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  126.5   7.6   3.9e-41   3.9e-41       3     150 .]      43     196 ..      41     196 .. 0.97

  Alignments for each domain:
  == domain 1  score: 126.5 bits;  conditional E-value: 3.9e-41
             DUF588   3 klrvaelvLRlaavvlalaaavvmatnkqtkevf....kiqveakfsdlpafvylvvanaiaavYsllqlvlsvvslvrkk..ersaalall 88 
                        + +va++vLR+++++++ +a+++m+t+++t +++    ++q++a +s +++++ylvv+++++++Ysl+ql++s  +l+rk+    ++++a++
  SwissProt::Q3EB59  43 RNDVAMFVLRAMCMAVSTVAVTLMVTARETSMTTlygfEFQLHAVWSLSDSLIYLVVVSSATVLYSLIQLIISGTRLMRKSpvIPTRTQAWF 134
                        66899*************************99999************************************************66667**** PP

             DUF588  89 lfllDqvlaylllsAasAaaavvylakkgnseaqWlkiCnqfgkFcervaaavalsflafll 150
                        +f++Dq++ y ++s+ sAa++v+++ ++g +++ + ++C++ g Fc++ a++++++++afll
  SwissProt::Q3EB59 135 CFVADQIIGYAMVSGGSAALGVTNMNRTGIRHMPLPNFCKSLGFFCDHLAGSIVFALFAFLL 196
                        ************************************************************85 PP



Or compare SwissProt::Q3EB59 to CDD or PaperBLAST